Universidade de Lisboa Repositório da Universidade de Lisboa

Repositório da Universidade de Lisboa >
Faculdade de Ciências (FC) >
FC - Dissertações de Mestrado >

Please use this identifier to cite or link to this item: http://hdl.handle.net/10451/5492

Title: Dengue virus infection and assembly: a biophysical study for unravelling the role of the Capsid Protein
Authors: Freire, João Miguel Calado da Silva
Advisor: Castanho, Miguel Augusto Rico Botas, 1967-
Coutinho, Ana Isabel Abrantes, 1965-
Keywords: Dengue virus
Flavivirus
Capsid Protein
Spectroscopy
DLS
Zeta potential
Fluorescence
LUV
Partition
Teses de mestrado - 2010
Issue Date: 2010
Abstract: O trabalho que foi desenvolvido durante esta dissertação foca-se no estudo do papel da proteína da cápside do vírus da Dengue durante o processo de infecção e encapsidação. A febre hemorrágica é um estado clínico que pode ser provocado por diversos agentes virais. Entre muitos, o vírus da Dengue é o principal causador desta doença a nível global podendo provocar cerca de 20 000 mortes, 500 000 hospitalizações e por volta de 100 milhões de infecções por ano. Os mosquitos da espécie Aedes spp. são os vectores deste vírus. Considerando os números alarmantes, não existe nenhum tratamento eficaz para a prevenção da infecção viral ou após a infecção, sendo uma das causas o pouco conhecimento acerca do mecanismo de infecção celular por parte do vírus da Dengue. O vírus da Dengue pertence ao género viral Favivirus pertencente à família Flaviridae. Estes vírus são envelopados, onde a cápside que contém uma molécula linear de RNA positivo está envolvida por uma bicamada lipídica (envelope) com inúmeras cópias de proteína do Envelope. Na literatura é sugerido que vírus envelopados entram pelo processo de fusão membranar para o interior do hospedeiro. Durante este processo de fusão a membrana viral e a do hospedeiro são destabilizadas, formando de seguida uma membrana única devido à fusão de ambas. devido a este processo a cápside que contém o genoma viral fica em contacto com o citoplasma do hospedeiro. Este processo de fusão pode ocorrer quer à superficie celular quer depois da internalização da partícula viral por endocitose. Os vírus da Dengue pertence à classe-II dos vírus de fusão, uma vez que a estrutura secundária da proteína do Envelope é maioritariamente em folhas β. A proteína do Envelope é o primeiro ponto de contacto entre as membranas do vírus e do hospedeiro. Alterações de pH devido à maturação endossomal provocam alterações conformacinais na proteina (passagem de dímero para trímero) que se acredita por ser o passo inicial no processo de fusão viral. Vários estudos recentes indicam também um papel relevante por parte da proteína da cápside (Proteína C) do vírus na infecção e encapsidação viral. A formação de partículas virulentas que contêm RNA viral é dependente da proteína C. A determinação da sua conformação sugere também uma participação activa desta proteína quer na interacção com o genoma viral quer com a membrana lípidica viral e posteriormente do hospedeiro. Esta afirmação deve-se à identificação de dois domínios altamente conservados no género Flavivírus, um muito hidrófobo (responsável pela interactção lipídica) e outro muito positivo (responsável pela interacção com o RNA). O mecanismo pelo qual ocorre a encapsidação é ainda desconhecido mas aponta-se para uma participação activa de proteínas virais não estruturais, a membrana do Reticulo Endoplasmático bem como a proteina C. A hipótese acima referida é também suportada pelo trabalho que foi desenvolvido nesta tese. O trabalho consistiu no estudo da interacção de dois péptidos, correspondentes a dois domínios conservados identificados na proteína da cápside, de forma a elucidar o papel desta proteína no mecanismo de infecção e de encapsidação viral. Foi estudada a interacção de ambos os péptidos com oligonucleotidos e membranas lipídicas por técnicas espectroscópicas recorrendo a vesículas fosfolipídicas como sistemas modelo de membranas. Estas vesículas foram preparadas de forma a mimetizarem tanto a composiçao lípidica da membrana celular e da membrana do retículo endoplasmatico. Os lípidos maioritariamente usados foram fosfolípidos com cadeias acilo palmitoíl e oleíl, ligados a uma fosfatidilcolina (POPC) ou a um fosfatidilglicerol (POPG). Utilizei membranas 100% POPC e PC:PG numa razão de 4:1 para modelos da membrana celular e do reticulo endoplasmatico respectivamente. Como modelo para o genoma viral utilizou-se uma molécula de 15 desoxiribonucelótidos. Recorreu-se a uma molecula de ssDNA devido às metodologias experimentais que foram utilizadas. A utilização de RNA necessita de várias precauções experimentais devido à existência de enzimas que degradam RNA, RNAses. Seria necessério utilizar todo o material (incluindo àgua MiliQ) num ambiente “RNAse free”. As experiencias efectuadas foram essencialmente titulações. Seria muito dificil manter as condições livres de RNAses durante um protocolod e titulação o que poderia gerar resultados contraditórios e dúbios. Dados da literatura mostram resultados concordantes entre experiências com RNA e o respectivo DNA razão pela qual este estudo também presseguiu com a molecula de ssDNA O péptido R (LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR) e o péptido M (KLFMALVAFLRFLTIPPTAGILKRWGTI), que correspondem, respectivamente, aos domínios com afinidade para RNA e membranas lipídicas da proteína da cápside mostraram ambos afinidade para bicamadas lipídicas (resultados de potecial-zeta, dispersao de luz dinâmica e fluorescência). A afinidade para membranas lipídicas por parte dos péptidos foi determinada segundo o formalismo de Nernst, onde a partição de um soluto entre dois ambientes imiscíveis (aquoso e lípidico) é quantificado pela constante de Partição, KP. Esta constante foi obtida pelo seguimento da fluorescência intrínseca dos péptidos, devido à presença do resíduo de Triptofano, quando eram titulados com uma solução de vesícula lipídicas. Experiências de dispersão de luz revelaram a formação de complexos de alta afinidade por parte de ambos os péptidos, R e M, com oligonucleotidos. A avaliação da estabilidade destes complexos de proteína/ DNA foi feita pela determinação das constantes de ligação. Esta quantificação foi realizada por estudos de quenching onde soluções de péptido foram tituladas com soluções de oligonucleotidos (actuando este como quencher). Estudos de temperatura e variação de pH foram também realizados de forma a observar alterações da estabilidade destes complexos. A constante de ligação dos péptidos R e M com os oligonucleotidos é respectivamente 0,071 e 0,065 μM não sendo significativamente alterada com variações de pH ou temperatura. De forma a observar a possivel interacção destes complexos com membranas lipídicas, um estudo preliminar com membranas marcadas com uma sonda fluorescence, DI-8-ANEPPS, mostrou a capacidade de particionar em membranas lipídicas destes complexos péptido/DNA. O grau de interacção dos complexos com as membranas foi também quantificado segundo o formalismo de Nernst recorrendo a um modelo de partição alterado. A alteração do formalismo matemático deste modelo consistiu na inserção de um equilibrio aquoso entre o péptido e as moleculas de oligonucleotido e a consideração da existência de duas partições em simultâneo. Ocorre a partição do péptido livre entre o meio aquoso e a bicamada lípidica bem como, após a formação do complexo molecular, a partição deste entre os ambientes aquoso e lipídico. Sendo assim através deste modelo é possivel determinar a constante de partição do complexo, KP,C ,sabendo a constante de partição do péptido livre, KP e a constante de ligação, Kb entre o péptido e o DNA. Estudos com os modelos de membrana celular e do reticulo mostram afinidade destes complexos para ambas as bicamadas lipídicas. Variações de pH não mostraram alterações significativas na afinidade destes complexos para a membrana. A integração destes resultados, em conjunto com literatura recente sugere um papel activo da proteína da cápside do vírus da dengue durante a infecção viral, funcionando como transportador intracelular do genoma viral ate ao local de tradução perto do núcleo. Durante a encapsidação, em vez da formação de uma cápside geométrica e bem ordenada, estes resultados e dados da literatura favorecem a formação de um novelo compacto de varias cópias de proteína envolvendo e compactando o genoma viral, um pouco á semelhança do empacotamento do nosso genoma por parte das histonas. Este trabalho abre portas para uma nova direcção no desenvolvimento de fármacos antivirais para o tratamento da infecção do vírus da dengue.
Viral hemorrhagic fever is a clinical syndrome caused by different viruses. Among the causative agents, Dengue Virus (DV), a member of Flavivirus gender, infection is by far the major cause of this disease in the world, with over 20.000 deaths, 500.000 hospitalizations and 50-100 million people infected every year. No effective treatment is available and DV infection mechanism remains unclear. Various studies point to the participation of the Dengue Virus Capsid Protein (DVCP) in viral assembly and infection wich are also supported by this work. Two peptides derived from two conserved domains from DVCP were studied with oligonucleotides and biological membrane models (Large Unilamellar Vesicles - LUV) using spectroscopical techniques. Peptide R (LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR) and Peptide M (KLFMALVAFLRFLTIPPTAGILKRWGTI) which are respectively the DVCP RNA-affinity and membrane-affinity identified domains revealed affinity for lipid bilayers (Dynamic Light Scatering - DLS, Zeta-Potential and Fluorescence results). Peptide-membrane binding was determined by the Nernst partition formalism. DLS with oligonucleotdies revealed peptide/oligonucleotides complex formation for both peptides. This high affinity for nucleotides was determined by fluorescence quenching where the binding constants for peptide R and M are respectively 0,071 and 0,065 μM. DI-8-ANEPPS assays showed the partition to lipid membranes of these complexes. A modified partition model was developed to determine the membrane partition constant of the complex, KP,C, Peptide R/M + nucleotide. For peptide R, for instance, complexation led to an increase in KP,C from 270 to 650 in POPC. The results suggest that in viral assembly, instead of a geometrically shell-like capsid, an amorphous complex of various DVCP repeats and ssRNA genome should be considered. With these results a new aproach for novel antiviral drugs can be ascribed, considering the active role of DVCP during viral assembly and infection.
Description: Tese de mestrado, Bioquímica, Universidade de Lisboa, Faculdade de Ciências, 2010
URI: http://hdl.handle.net/10451/5492
Appears in Collections:FC - Dissertações de Mestrado

Files in This Item:

File Description SizeFormat
ulfc096331_tm_João_Freire.pdf34.38 MBAdobe PDFView/Open
Restrict Access. You can request a copy!
Statistics
FacebookTwitterDeliciousLinkedInDiggGoogle BookmarksMySpaceOrkut
Formato BibTex mendeley Endnote Logotipo do DeGóis 

Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.

 

  © Universidade de Lisboa / SIBUL
Alameda da Universidade | Cidade Universitária | 1649-004 Lisboa | Portugal
Tel. +351 217967624 | Fax +351 217933624 | repositorio@reitoria.ul.pt - Feedback - Statistics
DeGóis
  Estamos no RCAAP Governo Português separator Ministério da Educação e Ciência   Fundação para a Ciência e a Tecnologia

Financiado por:

POS_C UE